Annual Review of Immunology
Cathelicidins — a family of multifunctional antimicrobial peptides
2009 · PMID 19125682
Zanetti M.
View source
Tissue Repair Compound
LL-37
Human cathelicidin antimicrobial peptide (hCAP-18 C-terminal 37-mer) studied in innate immunity and membrane-interaction research.
Units
1
Price
$53.99Out of stock
Est. delivery Thu, Jul 30–Wed, Aug 5 · COA included · Same-day ship before 2PM PT
Apple Pay · Google Pay · Visa · Amex · Discover
Compound information
Molecular profile
Technical specifications for laboratory reference
Molecular profile
What is LL-37?
Human cathelicidin antimicrobial peptide (hCAP-18 C-terminal 37-mer) studied in innate immunity and membrane-interaction research.
- Type
- Antimicrobial peptide
- CAS Number
- 154947-97-4
- Molecular Weight
- 4,493.2 g/mol
- Amino Acids
- 37
- Sequence
- [LL-37, 37 aa]
Storage requirements
Stability information
Protect from lightAvoid repeated freeze-thaw
Lyophilized (powder)
−20°C · up to 24 months
Reconstituted
2–8°C · up to 14 days
Literature
Sources & references
Peer-reviewed research for laboratory background
Citations are provided for research background only. Peptide Club materials are sold for laboratory research use — not for human or veterinary consumption. References do not constitute product claims.
